Lineage for d1mwva1 (1mwv A:35-440)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283714Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 283715Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 283975Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 283976Protein Catalase-peroxidase KatG [74754] (2 species)
    only the N-terminal CCP-like domain binds heme
  7. 283982Species Burkholderia pseudomallei [TaxId:28450] [89093] (1 PDB entry)
  8. 283983Domain d1mwva1: 1mwv A:35-440 [85161]

Details for d1mwva1

PDB Entry: 1mwv (more details), 1.7 Å

PDB Description: crystal structure of catalase-peroxidase katg of burkholderia pseudomallei

SCOP Domain Sequences for d1mwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOP Domain Coordinates for d1mwva1:

Click to download the PDB-style file with coordinates for d1mwva1.
(The format of our PDB-style files is described here.)

Timeline for d1mwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwva2