Lineage for d1mwva1 (1mwv A:35-440)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002464Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2002465Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2002950Family a.93.1.3: Catalase-peroxidase KatG [74753] (2 protein domains)
    duplication: tandem repeat of two CCP-like domains
  6. 2002951Protein Catalase-peroxidase KatG [74754] (4 species)
    only the N-terminal CCP-like domain binds heme
  7. 2002952Species Burkholderia pseudomallei [TaxId:28450] [89093] (21 PDB entries)
    Uniprot P13029 Q939D2 35-748
  8. 2002961Domain d1mwva1: 1mwv A:35-440 [85161]
    complexed with hem, na, peo

Details for d1mwva1

PDB Entry: 1mwv (more details), 1.7 Å

PDB Description: crystal structure of catalase-peroxidase katg of burkholderia pseudomallei
PDB Compounds: (A:) catalase-peroxidase protein KatG

SCOPe Domain Sequences for d1mwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mwva1 a.93.1.3 (A:35-440) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 28450]}
ngtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdw
wpadfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwp
ikqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsgg
pnsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetval
iagghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttp
tqwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrf
dpayekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOPe Domain Coordinates for d1mwva1:

Click to download the PDB-style file with coordinates for d1mwva1.
(The format of our PDB-style files is described here.)

Timeline for d1mwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mwva2