Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Bacterial alpha-amylase [51447] (10 species) |
Species Pyrococcus woesei [TaxId:2262] [89464] (3 PDB entries) |
Domain d1mwoa2: 1mwo A:1-361 [85160] Other proteins in same PDB: d1mwoa1 complexed with ca, zn |
PDB Entry: 1mwo (more details), 2.2 Å
SCOPe Domain Sequences for d1mwoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mwoa2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Pyrococcus woesei [TaxId: 2262]} akyleleeggvimqafywdvpgggiwwdhirskipewyeagisaiwlpppskgmsggysm gydpydyfdlgeyyqkgtvetrfgskeelvrliqtahaygikviadvvinhraggdlewn pfvgdytwtdfskvasgkytanyldfhpnelhccdegtfggfpdichhkewdqywlwksn esyaaylrsigfdgwrfdyvkgygawvvrdwlnwwggwavgeywdtnvdallswayesga kvfdfplyykmdeafdnnnipalvyalqngqtvvsrdpfkavtfvanhdtdiiwnkypay afiltyegqpvifyrdfeewlnkdklinliwihdhlaggsttivyydndelifvrngdsr r
Timeline for d1mwoa2: