Lineage for d1mvza_ (1mvz A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258855Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 2258856Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 2258857Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 2258871Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries)
  8. 2258873Domain d1mvza_: 1mvz A: [85158]

Details for d1mvza_

PDB Entry: 1mvz (more details)

PDB Description: NMR solution structure of a Bowman Birk inhibitor isolated from snail medic seeds (Medicago Scutellata)
PDB Compounds: (A:) Bowman-Birk type protease inhibitor, (MSTI)

SCOPe Domain Sequences for d1mvza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvza_ g.3.13.1 (A:) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]}
tkstttaccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps
cs

SCOPe Domain Coordinates for d1mvza_:

Click to download the PDB-style file with coordinates for d1mvza_.
(The format of our PDB-style files is described here.)

Timeline for d1mvza_: