Lineage for d1mvro_ (1mvr O:)

  1. Root: SCOP 1.71
  2. 627044Class i: Low resolution protein structures [58117] (24 folds)
  3. 627045Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 627046Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 627047Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 627048Protein 70S ribosome functional complex [58121] (3 species)
  7. 627637Species Thermus thermophilus [TaxId:274] [58122] (10 PDB entries)
  8. 627823Domain d1mvro_: 1mvr O: [85155]

Details for d1mvro_

PDB Entry: 1mvr (more details)

PDB Description: decoding center & peptidyl transferase center from the x-ray structure of the thermus thermophilus 70s ribosome, aligned to the low resolution cryo-em map of e.coli 70s ribosome

SCOP Domain Sequences for d1mvro_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvro_ i.1.1.1 (O:) 70S ribosome functional complex {Thermus thermophilus}
ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
pkea

SCOP Domain Coordinates for d1mvro_:

Click to download the PDB-style file with coordinates for d1mvro_.
(The format of our PDB-style files is described here.)

Timeline for d1mvro_: