Lineage for d1mvrl_ (1mvr L:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1248420Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 1248421Protein 70S ribosome functional complex [58121] (9 species)
  7. 1249067Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)
  8. 1249269Domain d1mvrl_: 1mvr L: [85154]

Details for d1mvrl_

PDB Entry: 1mvr (more details), 12.8 Å

PDB Description: decoding center & peptidyl transferase center from the x-ray structure of the thermus thermophilus 70s ribosome, aligned to the low resolution cryo-em map of e.coli 70s ribosome
PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1mvrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvrl_ i.1.1.1 (L:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

SCOPe Domain Coordinates for d1mvrl_:

Click to download the PDB-style file with coordinates for d1mvrl_.
(The format of our PDB-style files is described here.)

Timeline for d1mvrl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mvro_