SCOPe 2.01: Domain d1mvrl_: 1mvr L:

Lineage for d1mvrl_ (1mvr L:)

1. Root: SCOPe 2.01

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (9 species)

7. Species Thermus thermophilus [TaxId:274] [58122] (21 PDB entries)

8. Domain d1mvrl_: 1mvr L: [85154]

Details for d1mvrl_

PDB Entry: 1mvr, 12.8 Å

PDB Description: decoding center & peptidyl transferase center from the x-ray structure of the thermus thermophilus 70s ribosome, aligned to the low resolution cryo-em map of e.coli 70s ribosome

PDB Compounds: (L:) 50S ribosomal protein L11

SCOPe Domain Sequences for d1mvrl_:

Sequence; same for both SEQRES and ATOM records:

>d1mvrl_ i.1.1.1 (L:) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
iegtaksmgievv

Timeline for d1mvrl_:

• d1mvrl_ first appeared in SCOP 1.65
  
• d1mvrl_ appears in SCOP 1.75
  
• d1mvrl_ appears in SCOPe 2.02
  
• d1mvrl_ appears in the current release, SCOPe 2.08