Lineage for d1mvla_ (1mvl A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108181Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108182Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2108183Family c.34.1.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52508] (4 protein domains)
    Pfam PF02441; formerly DFP, DNA/pantothenate metabolism flavoprotein family
  6. 2108184Protein 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) [52509] (2 species)
    involved in signal transduction; binds FMN
  7. 2108190Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [52510] (3 PDB entries)
  8. 2108191Domain d1mvla_: 1mvl A: [85146]
    complexed with fmn; mutant

Details for d1mvla_

PDB Entry: 1mvl (more details), 2 Å

PDB Description: PPC decarboxylase mutant C175S
PDB Compounds: (A:) PPC decarboxylase AtHAL3a

SCOPe Domain Sequences for d1mvla_:

Sequence, based on SEQRES records: (download)

>d1mvla_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kprvllaasgsvaaikfgnlchcftewaevravvtksslhfldklslpqevtlytdedew
sswnkigdpvlhielrrwadvlviaplsantlgkiagglcdnlltciirawdytkplfva
pamntlmwnnpfterhllsldelgitlippikkrlasgdygngamaepsliystvrlfwe
sq

Sequence, based on observed residues (ATOM records): (download)

>d1mvla_ c.34.1.1 (A:) 4'-phosphopantothenoylcysteine decarboxylase (PPC decarboxylase, halotolerance protein Hal3a) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kprvllaasgsvaaikfgnlchcftewaevravvtksslhfldklslpqevtlytdedew
sswnkigdpvlhielrrwadvlviaplsantlgkiagglcdnlltciirawdytkplfva
pamntlmwnnpfterhllsldelgitlippikngamaepsliystvrlfwesq

SCOPe Domain Coordinates for d1mvla_:

Click to download the PDB-style file with coordinates for d1mvla_.
(The format of our PDB-style files is described here.)

Timeline for d1mvla_: