Lineage for d1mvea_ (1mve A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294823Family b.29.1.2: beta-Glucanase-like [49925] (2 proteins)
  6. 294824Protein Bacillus 1-3,1-4-beta-glucanase [49926] (4 species)
  7. 294838Species Fibrobacter succinogenes [TaxId:833] [89270] (1 PDB entry)
    a natural circularly permuted protein
  8. 294839Domain d1mvea_: 1mve A: [85140]
    complexed with ca, mse; mutant

Details for d1mvea_

PDB Entry: 1mve (more details), 1.7 Å

PDB Description: crystal structure of a natural circularly-permutated jellyroll protein: 1,3-1,4-beta-d-glucanase from fibrobacter succinogenes

SCOP Domain Sequences for d1mvea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mvea_ b.29.1.2 (A:) Bacillus 1-3,1-4-beta-glucanase {Fibrobacter succinogenes}
mvsakdfsgaelytleevqygkfearmkmaaasgtvssmflyqngseiadgrpwvevdie
vlgknpgsfqsniitgkagaqktsekhhavspaadqafhtyglewtpnyvrwtvdgqevr
kteggqvsnltgtqglrfnlwssesaawvgqfdesklplfqfinwvkvykytpgqgeggs
dftldwtdnfdtfdgsrwgkgdwtfdgnrvdltdkniysrdgmlilaltrkgqesfngqv
prd

SCOP Domain Coordinates for d1mvea_:

Click to download the PDB-style file with coordinates for d1mvea_.
(The format of our PDB-style files is described here.)

Timeline for d1mvea_: