Lineage for d1mv8c3 (1mv8 C:301-436)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861677Superfamily c.26.3: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52413] (1 family) (S)
  5. 2861678Family c.26.3.1: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52414] (2 proteins)
  6. 2861679Protein GDP-mannose 6-dehydrogenase, GDP-binding domain [89617] (1 species)
  7. 2861680Species Pseudomonas aeruginosa [TaxId:287] [89618] (3 PDB entries)
  8. 2861683Domain d1mv8c3: 1mv8 C:301-436 [85136]
    Other proteins in same PDB: d1mv8a1, d1mv8a2, d1mv8b1, d1mv8b2, d1mv8c1, d1mv8c2, d1mv8d1, d1mv8d2
    complexed with acy, gdx, mpd, nad

Details for d1mv8c3

PDB Entry: 1mv8 (more details), 1.55 Å

PDB Description: 1.55 a crystal structure of a ternary complex of gdp-mannose dehydrogenase from psuedomonas aeruginosa
PDB Compounds: (C:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1mv8c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv8c3 c.26.3.1 (C:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]}
vqkafdlitshdtrkvgllglsfkagtddlresplvelaemligkgyelrifdrnveyar
vhgankeyieskiphvssllvsdldevvassdvlvlgngdelfvdlvnktpsgkklvdlv
gfmphtttaqaegicw

SCOPe Domain Coordinates for d1mv8c3:

Click to download the PDB-style file with coordinates for d1mv8c3.
(The format of our PDB-style files is described here.)

Timeline for d1mv8c3: