| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins) automatically mapped to Pfam PF00984 |
| Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species) forms segment-swapped dimer, unlike the homologous UDPGDH domain |
| Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries) |
| Domain d1mv8c1: 1mv8 C:203-300 [85134] Other proteins in same PDB: d1mv8a2, d1mv8a3, d1mv8b2, d1mv8b3, d1mv8c2, d1mv8c3, d1mv8d2, d1mv8d3 complexed with acy, gdx, mpd, nad |
PDB Entry: 1mv8 (more details), 1.55 Å
SCOPe Domain Sequences for d1mv8c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mv8c1 a.100.1.4 (C:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf
afggsclpkdvraltyrasqldvehpmlgslmrsnsnq
Timeline for d1mv8c1: