Lineage for d1mv8b2 (1mv8 B:1-202)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844998Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2845053Protein GDP-mannose 6-dehydrogenase [89534] (1 species)
  7. 2845054Species Pseudomonas aeruginosa [TaxId:287] [89535] (3 PDB entries)
  8. 2845056Domain d1mv8b2: 1mv8 B:1-202 [85132]
    Other proteins in same PDB: d1mv8a1, d1mv8a3, d1mv8b1, d1mv8b3, d1mv8c1, d1mv8c3, d1mv8d1, d1mv8d3
    complexed with acy, gdx, mpd, nad

Details for d1mv8b2

PDB Entry: 1mv8 (more details), 1.55 Å

PDB Description: 1.55 a crystal structure of a ternary complex of gdp-mannose dehydrogenase from psuedomonas aeruginosa
PDB Compounds: (B:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1mv8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv8b2 c.2.1.6 (B:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
mrisifglgyvgavcagclsarghevigvdvsstkidlinqgkspivepgleallqqgrq
tgrlsgttdfkkavldsdvsficvgtpskkngdldlgyietvcreigfairekserhtvv
vrstvlpgtvnnvvipliedcsgkkagvdfgvgtnpeflrestaikdydfppmtvigeld
kqtgdlleeiyreldapiirkt

SCOPe Domain Coordinates for d1mv8b2:

Click to download the PDB-style file with coordinates for d1mv8b2.
(The format of our PDB-style files is described here.)

Timeline for d1mv8b2: