Lineage for d1mv8b1 (1mv8 B:203-300)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334531Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins)
    automatically mapped to Pfam PF00984
  6. 2334532Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species)
    forms segment-swapped dimer, unlike the homologous UDPGDH domain
  7. 2334533Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries)
  8. 2334535Domain d1mv8b1: 1mv8 B:203-300 [85131]
    Other proteins in same PDB: d1mv8a2, d1mv8a3, d1mv8b2, d1mv8b3, d1mv8c2, d1mv8c3, d1mv8d2, d1mv8d3
    complexed with acy, gdx, mpd, nad, suc

Details for d1mv8b1

PDB Entry: 1mv8 (more details), 1.55 Å

PDB Description: 1.55 a crystal structure of a ternary complex of gdp-mannose dehydrogenase from psuedomonas aeruginosa
PDB Compounds: (B:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1mv8b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mv8b1 a.100.1.4 (B:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf
afggsclpkdvraltyrasqldvehpmlgslmrsnsnq

SCOPe Domain Coordinates for d1mv8b1:

Click to download the PDB-style file with coordinates for d1mv8b1.
(The format of our PDB-style files is described here.)

Timeline for d1mv8b1: