Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (18 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein GDP-mannose 6-dehydrogenase [89534] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [89535] (3 PDB entries) |
Domain d1mv8a2: 1mv8 A:1-202 [85129] Other proteins in same PDB: d1mv8a1, d1mv8a3, d1mv8b1, d1mv8b3, d1mv8c1, d1mv8c3, d1mv8d1, d1mv8d3 |
PDB Entry: 1mv8 (more details), 1.55 Å
SCOP Domain Sequences for d1mv8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} mrisifglgyvgavcagclsarghevigvdvsstkidlinqgkspivepgleallqqgrq tgrlsgttdfkkavldsdvsficvgtpskkngdldlgyietvcreigfairekserhtvv vrstvlpgtvnnvvipliedcsgkkagvdfgvgtnpeflrestaikdydfppmtvigeld kqtgdlleeiyreldapiirkt
Timeline for d1mv8a2: