Lineage for d1muud3 (1muu D:301-436)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1842598Superfamily c.26.3: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52413] (1 family) (S)
  5. 1842599Family c.26.3.1: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52414] (2 proteins)
  6. 1842600Protein GDP-mannose 6-dehydrogenase, GDP-binding domain [89617] (1 species)
  7. 1842601Species Pseudomonas aeruginosa [TaxId:287] [89618] (3 PDB entries)
  8. 1842609Domain d1muud3: 1muu D:301-436 [85127]
    Other proteins in same PDB: d1muua1, d1muua2, d1muub1, d1muub2, d1muuc1, d1muuc2, d1muud1, d1muud2
    complexed with gdx, nad, suc

Details for d1muud3

PDB Entry: 1muu (more details), 2.02 Å

PDB Description: 2.0 a crystal structure of gdp-mannose dehydrogenase
PDB Compounds: (D:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1muud3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muud3 c.26.3.1 (D:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]}
vqkafdlitshdtrkvgllglsfkagtddlresplvelaemligkgyelrifdrnveyar
vhgankeyieskiphvssllvsdldevvassdvlvlgngdelfvdlvnktpsgkklvdlv
gfmphtttaqaegicw

SCOPe Domain Coordinates for d1muud3:

Click to download the PDB-style file with coordinates for d1muud3.
(The format of our PDB-style files is described here.)

Timeline for d1muud3: