Lineage for d1muud2 (1muu D:1-202)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106072Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 2106127Protein GDP-mannose 6-dehydrogenase [89534] (1 species)
  7. 2106128Species Pseudomonas aeruginosa [TaxId:287] [89535] (3 PDB entries)
  8. 2106136Domain d1muud2: 1muu D:1-202 [85126]
    Other proteins in same PDB: d1muua1, d1muua3, d1muub1, d1muub3, d1muuc1, d1muuc3, d1muud1, d1muud3
    complexed with gdx, nad, suc

Details for d1muud2

PDB Entry: 1muu (more details), 2.02 Å

PDB Description: 2.0 a crystal structure of gdp-mannose dehydrogenase
PDB Compounds: (D:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1muud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muud2 c.2.1.6 (D:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
mrisifglgyvgavcagclsarghevigvdvsstkidlinqgkspivepgleallqqgrq
tgrlsgttdfkkavldsdvsficvgtpskkngdldlgyietvcreigfairekserhtvv
vrstvlpgtvnnvvipliedcsgkkagvdfgvgtnpeflrestaikdydfppmtvigeld
kqtgdlleeiyreldapiirkt

SCOPe Domain Coordinates for d1muud2:

Click to download the PDB-style file with coordinates for d1muud2.
(The format of our PDB-style files is described here.)

Timeline for d1muud2: