Lineage for d1muud2 (1muu D:1-202)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 309007Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 309044Protein GDP-mannose 6-dehydrogenase [89534] (1 species)
  7. 309045Species Pseudomonas aeruginosa [TaxId:287] [89535] (3 PDB entries)
  8. 309053Domain d1muud2: 1muu D:1-202 [85126]
    Other proteins in same PDB: d1muua1, d1muua3, d1muub1, d1muub3, d1muuc1, d1muuc3, d1muud1, d1muud3
    complexed with gdx, mse, nad, suc

Details for d1muud2

PDB Entry: 1muu (more details), 2 Å

PDB Description: 2.0 a crystal structure of gdp-mannose dehydrogenase

SCOP Domain Sequences for d1muud2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muud2 c.2.1.6 (D:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa}
mrisifglgyvgavcagclsarghevigvdvsstkidlinqgkspivepgleallqqgrq
tgrlsgttdfkkavldsdvsficvgtpskkngdldlgyietvcreigfairekserhtvv
vrstvlpgtvnnvvipliedcsgkkagvdfgvgtnpeflrestaikdydfppmtvigeld
kqtgdlleeiyreldapiirkt

SCOP Domain Coordinates for d1muud2:

Click to download the PDB-style file with coordinates for d1muud2.
(The format of our PDB-style files is described here.)

Timeline for d1muud2: