Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins) automatically mapped to Pfam PF00984 |
Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species) forms segment-swapped dimer, unlike the homologous UDPGDH domain |
Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries) |
Domain d1muud1: 1muu D:203-300 [85125] Other proteins in same PDB: d1muua2, d1muua3, d1muub2, d1muub3, d1muuc2, d1muuc3, d1muud2, d1muud3 complexed with gdx, nad, suc |
PDB Entry: 1muu (more details), 2.02 Å
SCOPe Domain Sequences for d1muud1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muud1 a.100.1.4 (D:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf afggsclpkdvraltyrasqldvehpmlgslmrsnsnq
Timeline for d1muud1: