Lineage for d1muud1 (1muu D:203-300)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2721323Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2721324Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2721433Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins)
    automatically mapped to Pfam PF00984
  6. 2721434Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species)
    forms segment-swapped dimer, unlike the homologous UDPGDH domain
  7. 2721435Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries)
  8. 2721443Domain d1muud1: 1muu D:203-300 [85125]
    Other proteins in same PDB: d1muua2, d1muua3, d1muub2, d1muub3, d1muuc2, d1muuc3, d1muud2, d1muud3
    complexed with gdx, nad

Details for d1muud1

PDB Entry: 1muu (more details), 2.02 Å

PDB Description: 2.0 a crystal structure of gdp-mannose dehydrogenase
PDB Compounds: (D:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1muud1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muud1 a.100.1.4 (D:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf
afggsclpkdvraltyrasqldvehpmlgslmrsnsnq

SCOPe Domain Coordinates for d1muud1:

Click to download the PDB-style file with coordinates for d1muud1.
(The format of our PDB-style files is described here.)

Timeline for d1muud1: