| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
| Protein GDP-mannose 6-dehydrogenase [89534] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [89535] (3 PDB entries) |
| Domain d1muub2: 1muu B:1-202 [85120] Other proteins in same PDB: d1muua1, d1muua3, d1muub1, d1muub3, d1muuc1, d1muuc3, d1muud1, d1muud3 complexed with gdx, nad |
PDB Entry: 1muu (more details), 2.02 Å
SCOPe Domain Sequences for d1muub2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muub2 c.2.1.6 (B:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]}
mrisifglgyvgavcagclsarghevigvdvsstkidlinqgkspivepgleallqqgrq
tgrlsgttdfkkavldsdvsficvgtpskkngdldlgyietvcreigfairekserhtvv
vrstvlpgtvnnvvipliedcsgkkagvdfgvgtnpeflrestaikdydfppmtvigeld
kqtgdlleeiyreldapiirkt
Timeline for d1muub2: