| Class a: All alpha proteins [46456] (179 folds) |
| Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
| Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins) |
| Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species) forms segment-swapped dimer, unlike the homologous UDPGDH domain |
| Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries) |
| Domain d1muub1: 1muu B:203-300 [85119] Other proteins in same PDB: d1muua2, d1muua3, d1muub2, d1muub3, d1muuc2, d1muuc3, d1muud2, d1muud3 |
PDB Entry: 1muu (more details), 2 Å
SCOP Domain Sequences for d1muub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muub1 a.100.1.4 (B:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa}
vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf
afggsclpkdvraltyrasqldvehpmlgslmrsnsnq
Timeline for d1muub1: