Lineage for d1muua3 (1muu A:301-436)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2120339Superfamily c.26.3: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52413] (1 family) (S)
  5. 2120340Family c.26.3.1: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52414] (2 proteins)
  6. 2120341Protein GDP-mannose 6-dehydrogenase, GDP-binding domain [89617] (1 species)
  7. 2120342Species Pseudomonas aeruginosa [TaxId:287] [89618] (3 PDB entries)
  8. 2120347Domain d1muua3: 1muu A:301-436 [85118]
    Other proteins in same PDB: d1muua1, d1muua2, d1muub1, d1muub2, d1muuc1, d1muuc2, d1muud1, d1muud2
    complexed with gdx, nad, suc

Details for d1muua3

PDB Entry: 1muu (more details), 2.02 Å

PDB Description: 2.0 a crystal structure of gdp-mannose dehydrogenase
PDB Compounds: (A:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1muua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muua3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]}
vqkafdlitshdtrkvgllglsfkagtddlresplvelaemligkgyelrifdrnveyar
vhgankeyieskiphvssllvsdldevvassdvlvlgngdelfvdlvnktpsgkklvdlv
gfmphtttaqaegicw

SCOPe Domain Coordinates for d1muua3:

Click to download the PDB-style file with coordinates for d1muua3.
(The format of our PDB-style files is described here.)

Timeline for d1muua3: