Lineage for d1muqd_ (1muq D:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614387Protein Galactose-specific C-type lectin [90061] (1 species)
  7. 614388Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries)
  8. 614397Domain d1muqd_: 1muq D: [85114]

Details for d1muqd_

PDB Entry: 1muq (more details), 2.3 Å

PDB Description: x-ray crystal structure of rattlesnake venom complexed with thiodigalactoside

SCOP Domain Sequences for d1muqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1muqd_ d.169.1.1 (D:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox)}
ncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyhk
gqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwndq
vceskdaflcqckf

SCOP Domain Coordinates for d1muqd_:

Click to download the PDB-style file with coordinates for d1muqd_.
(The format of our PDB-style files is described here.)

Timeline for d1muqd_: