|  | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) | 
|  | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold | 
|  | Superfamily d.169.1: C-type lectin-like [56436] (6 families)  | 
|  | Family d.169.1.1: C-type lectin domain [56437] (22 proteins) | 
|  | Protein Galactose-specific C-type lectin [90061] (1 species) | 
|  | Species Western diamondback rattlesnake (Crotalus atrox) [TaxId:8730] [90062] (2 PDB entries) | 
|  | Domain d1muqa_: 1muq A: [85111] | 
PDB Entry: 1muq (more details), 2.3 Å
SCOP Domain Sequences for d1muqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muqa_ d.169.1.1 (A:) Galactose-specific C-type lectin {Western diamondback rattlesnake (Crotalus atrox)}
ncpldwlpmnglcykifnqlktwedaemfcrkykpgchlasfhrygesleiaeyisdyhk
gqenvwiglrdkkkdfswewtdrsctdyltwdknqpdhyqnkefcvelvsltgyrlwndq
vceskdaflcqckf
Timeline for d1muqa_:
|  View in 3D Domains from other chains: (mouse over for more information) d1muqb_, d1muqc_, d1muqd_, d1muqe_ |