Lineage for d1muma_ (1mum A:)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) 
Family c.1.12.7: Phosphoenolpyruvate mutase/Isocitrate lyase-like [88704] (3 proteins)
forms a swapped dimer
Protein 2-methylisocitrate lyase [89499] (1 species) Species Escherichia coli [TaxId:562] [89500] (1 PDB entry) 
Domain d1muma_: 1mum A: [85108]
Details for d1muma_
PDB Entry: 1mum (more details), 1.9 Å
PDB Description: structure of the 2-methylisocitrate lyase (prpb) from escherichia coli
SCOP Domain Sequences for d1muma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli}
lhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgis
tlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakr
cghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveaga
emlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafra
mnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa
SCOP Domain Coordinates for d1muma_:
Click to download the PDB-style file with coordinates for d1muma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1muma_:
- d1muma_ is new in SCOP 1.65
- d1muma_ appears in SCOP 1.67
- d1muma_ appears in the current release, SCOPe 2.08
View in 3D
