SCOPe 2.08: Domain d1mtp.1: 1mtp A:,B:

Lineage for d1mtp.1 (1mtp A:,B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.1: Serpins [56573] (1 superfamily)
   contains a cluster of helices and a beta-sandwich

4. Superfamily e.1.1: Serpins [56574] (2 families)

5. Family e.1.1.1: Serpins [56575] (17 proteins)
   automatically mapped to Pfam PF00079

6. Protein Thermopin [90080] (1 species)
   Serpin from a thermophilic prokaryote

7. Species Thermobifida fusca [TaxId:2021] [90081] (2 PDB entries)
   Uniprot Q47NK3

8. Domain d1mtp.1: 1mtp A:,B: [85107]
   structural genomics

Details for d1mtp.1

PDB Entry: 1mtp, 1.5 Å

PDB Description: the x-ray crystal structure of a serpin from a thermophilic prokaryote

PDB Compounds: (A:) Serine Proteinase Inhibitor (SERPIN), Chain A, (B:) Serine Proteinase Inhibitor (SERPIN), Chain B

SCOPe Domain Sequences for d1mtp.1:

Sequence; same for both SEQRES and ATOM records:

>g1mtp.1 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [TaxId: 2021]}
ggflrddhlefalhlhrrlaeavpdgeviwspysvacalgvlaagarattrtelttllgt
dpapllaaldravtdspdlasrtvlwvsadvpvrssfratmhdrpdsdvrtadfrtnpeg
vratvnadiadatrgmirellpqgavtpdlrailtnalwakarwttpfeahltregtfrt
prgpkrvpfmhrtktmpyatargwrmvtlhahdelavdvllppgtnaaavptaplltalh
rrsastsvelalprfeltqphqlvevlaeagvrtlftasadlsgistvplyvdtvihqar
lrvdergaegaaataammllXtirfsvdrpfhivvrrrgailflgsiadphdpgpa

Timeline for d1mtp.1:

• d1mtp.1 first appeared in SCOP 1.65
  
• d1mtp.1 appears in SCOPe 2.07