Lineage for d1mt1.5 (1mt1 I:,J:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335982Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
    duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich
  4. 335983Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families) (S)
    two chains result from self-processing single-chain precursor; form heterohexamer
  5. 336004Family d.155.1.2: Arginine decarboxylase [90046] (1 protein)
  6. 336005Protein Arginine decarboxylase [90047] (1 species)
  7. 336006Species Archaeon Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)
  8. 336017Domain d1mt1.5: 1mt1 I:,J: [85101]

Details for d1mt1.5

PDB Entry: 1mt1 (more details), 2.2 Å

PDB Description: the crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannaschii

SCOP Domain Sequences for d1mt1.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g1mt1.5 d.155.1.2 (I:,J:) Arginine decarboxylase {Archaeon Methanococcus jannaschii}
einplhayfklpntvslvagssegetplnafdgallnagignvnlirisXimppeaeivp
lpklpmgalvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektv
remakigfemrgweldriesiavehtveklgcafaaaalwyk

SCOP Domain Coordinates for d1mt1.5:

Click to download the PDB-style file with coordinates for d1mt1.5.
(The format of our PDB-style files is described here.)

Timeline for d1mt1.5: