SCOPe 2.05: Domain d1mt1.4: 1mt1 G:,H:

Lineage for d1mt1.4 (1mt1 G:,H:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
   duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich

4. Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families)
   two chains result from self-processing single-chain precursor; form heterohexamer

5. Family d.155.1.2: Arginine decarboxylase [90046] (2 proteins)

6. Protein Arginine decarboxylase [90047] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [90048] (3 PDB entries)

8. Domain d1mt1.4: 1mt1 G:,H: [85100]
   complexed with ag2

Details for d1mt1.4

PDB Entry: 1mt1, 2.2 Å

PDB Description: the crystal structure of pyruvoyl-dependent arginine decarboxylase from methanococcus jannaschii

PDB Compounds: (G:) pyruvoyl-dependent arginine decarboxylase beta chain, (H:) pyruvoyl-dependent arginine decarboxylase alpha chain

SCOPe Domain Sequences for d1mt1.4:

Sequence; same for both SEQRES and ATOM records:

>g1mt1.4 d.155.1.2 (G:,H:) Arginine decarboxylase {Methanococcus jannaschii [TaxId: 2190]}
fklpntvslvagssegetplnafdgallnagignvnlirisXximppeaeivplpklpmg
alvptaygyiisdvpgetisaaisvaipkdkslcglimeyegkcskkeaektvremakig
femrgweldriesiavehtveklgcafaaaalwyk

Timeline for d1mt1.4:

• d1mt1.4 first appeared in SCOP 1.65
  
• d1mt1.4 appears in SCOPe 2.04
  
• d1mt1.4 appears in SCOPe 2.06
  
• d1mt1.4 appears in the current release, SCOPe 2.08