Lineage for d1ms9b1 (1ms9 B:409-633)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371950Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 371951Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 371952Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89271] (8 PDB entries)
  8. 371954Domain d1ms9b1: 1ms9 B:409-633 [85090]
    Other proteins in same PDB: d1ms9a2, d1ms9b2
    complexed with lat; mutant

Details for d1ms9b1

PDB Entry: 1ms9 (more details), 1.58 Å

PDB Description: triclinic form of trypanosoma cruzi trans-sialidase, in complex with lactose

SCOP Domain Sequences for d1ms9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms9b1 b.29.1.15 (B:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi)}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahm

SCOP Domain Coordinates for d1ms9b1:

Click to download the PDB-style file with coordinates for d1ms9b1.
(The format of our PDB-style files is described here.)

Timeline for d1ms9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms9b2