Lineage for d1ms9a2 (1ms9 A:2-399)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 468803Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 468804Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 468805Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 468922Protein Trypanosoma sialidase [82164] (2 species)
  7. 468923Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89371] (11 PDB entries)
  8. 468924Domain d1ms9a2: 1ms9 A:2-399 [85089]
    Other proteins in same PDB: d1ms9a1, d1ms9b1

Details for d1ms9a2

PDB Entry: 1ms9 (more details), 1.58 Å

PDB Description: triclinic form of trypanosoma cruzi trans-sialidase, in complex with lactose

SCOP Domain Sequences for d1ms9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms9a2 b.68.1.1 (A:2-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi)}
apgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdns
lidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsywt
shgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagv
aivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkli
intrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvml
fthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheinsn
evyslvfarlvgelriiksvlqswknwdshlssictpa

SCOP Domain Coordinates for d1ms9a2:

Click to download the PDB-style file with coordinates for d1ms9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ms9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms9a1