Lineage for d1ms7a_ (1ms7 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 321832Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 321833Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 321834Family c.94.1.1: Phosphate binding protein-like [53851] (21 protein domains)
  6. 321913Protein Glutamate receptor ligand binding core [53881] (2 species)
  7. 321914Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (39 PDB entries)
  8. 321954Domain d1ms7a_: 1ms7 A: [85081]

Details for d1ms7a_

PDB Entry: 1ms7 (more details), 1.97 Å

PDB Description: x-ray structure of the glur2 ligand-binding core (s1s2j) in complex with (s)-des-me-ampa at 1.97 a resolution, crystallization in the presence of zinc acetate

SCOP Domain Sequences for d1ms7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms7a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec

SCOP Domain Coordinates for d1ms7a_:

Click to download the PDB-style file with coordinates for d1ms7a_.
(The format of our PDB-style files is described here.)

Timeline for d1ms7a_: