SCOP 1.67: Domain d1ms4a1: 1ms4 A:409-632

Lineage for d1ms4a1 (1ms4 A:409-632)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)

6. Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)

7. Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89271] (8 PDB entries)

8. Domain d1ms4a1: 1ms4 A:409-632 [85072]
   Other proteins in same PDB: d1ms4a2, d1ms4b2

Details for d1ms4a1

PDB Entry: 1ms4, 2.21 Å

PDB Description: triclinic form of trypanosoma cruzi trans-sialidase

SCOP Domain Sequences for d1ms4a1:

Sequence; same for both SEQRES and ATOM records:

>d1ms4a1 b.29.1.15 (A:409-632) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi)}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah

Timeline for d1ms4a1:

• d1ms4a1 first appeared in SCOP 1.65
  
• d1ms4a1 appears in SCOP 1.69
  
• d1ms4a1 appears in the current release, SCOPe 2.08