Lineage for d1ms3b1 (1ms3 B:409-632)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 295172Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 295173Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 295174Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89271] (8 PDB entries)
  8. 295178Domain d1ms3b1: 1ms3 B:409-632 [85070]
    Other proteins in same PDB: d1ms3a2, d1ms3b2
    mutant

Details for d1ms3b1

PDB Entry: 1ms3 (more details), 1.65 Å

PDB Description: Monoclinic form of Trypanosoma cruzi trans-sialidase

SCOP Domain Sequences for d1ms3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms3b1 b.29.1.15 (B:409-632) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi)}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah

SCOP Domain Coordinates for d1ms3b1:

Click to download the PDB-style file with coordinates for d1ms3b1.
(The format of our PDB-style files is described here.)

Timeline for d1ms3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms3b2