Lineage for d1ms3a2 (1ms3 A:1-399)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379505Fold b.68: 6-bladed beta-propeller [50938] (10 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 379506Superfamily b.68.1: Sialidases (neuraminidases) [50939] (1 family) (S)
  5. 379507Family b.68.1.1: Sialidases (neuraminidases) [50940] (8 proteins)
  6. 379624Protein Trypanosoma sialidase [82164] (2 species)
  7. 379625Species Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId:5693] [89371] (8 PDB entries)
  8. 379628Domain d1ms3a2: 1ms3 A:1-399 [85069]
    Other proteins in same PDB: d1ms3a1, d1ms3b1

Details for d1ms3a2

PDB Entry: 1ms3 (more details), 1.65 Å

PDB Description: monoclinic form of trypanosoma cruzi trans-sialidase

SCOP Domain Sequences for d1ms3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms3a2 b.68.1.1 (A:1-399) Trypanosoma sialidase {Parasitic flagellate protozoan (Trypanosoma cruzi)}
lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
nevyslvfarlvgelriiksvlqswknwdshlssictpa

SCOP Domain Coordinates for d1ms3a2:

Click to download the PDB-style file with coordinates for d1ms3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ms3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms3a1