Lineage for d1ms0b1 (1ms0 B:409-632)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780425Family b.29.1.15: Trypanosoma sialidase, C-terminal domain [82038] (1 protein)
  6. 2780426Protein Trypanosoma sialidase, C-terminal domain [82039] (2 species)
  7. 2780427Species Trypanosoma cruzi [TaxId:5693] [89271] (13 PDB entries)
    Uniprot Q26966
  8. 2780447Domain d1ms0b1: 1ms0 B:409-632 [85062]
    Other proteins in same PDB: d1ms0a2, d1ms0b2
    complexed with dan

Details for d1ms0b1

PDB Entry: 1ms0 (more details), 2.5 Å

PDB Description: monoclinic form of trypanosoma cruzi trans-sialidase, in complex with 3-deoxy-2,3-dehydro-n-acetylneuraminic acid (dana)and lactose
PDB Compounds: (B:) Trans-sialidase

SCOPe Domain Sequences for d1ms0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ms0b1 b.29.1.15 (B:409-632) Trypanosoma sialidase, C-terminal domain {Trypanosoma cruzi [TaxId: 5693]}
gcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpvsq
qgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqpiy
gstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyvgg
ykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteah

SCOPe Domain Coordinates for d1ms0b1:

Click to download the PDB-style file with coordinates for d1ms0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ms0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ms0b2