![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) ![]() |
![]() | Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins) |
![]() | Protein Alpha-amino acid ester hydrolase [89247] (2 species) |
![]() | Species Xanthomonas citri [TaxId:346] [89248] (1 PDB entry) |
![]() | Domain d1mpxd1: 1mpx D:405-637 [85047] Other proteins in same PDB: d1mpxa2, d1mpxb2, d1mpxc2, d1mpxd2 complexed with ca, gol, mse |
PDB Entry: 1mpx (more details), 1.9 Å
SCOP Domain Sequences for d1mpxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpxd1 b.18.1.13 (D:405-637) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} prscdkgcaatskplylqaggklsfqppvagqagfeeyvsdpakpvpfvprpvdfadram wttwlvhdqrfvdgrpdvltfvteplteplqiagapdvhlqastsgsdsdwvvklidvyp eemasnpkmggyelpvslaifrgryresfstpkpltsnqplafqfglptanhtfqpghrv mvqvqsslfplydrnpqtyvpniffakpgdyqkatqrvyvspeqpsyislpvr
Timeline for d1mpxd1: