Lineage for d1mpxd1 (1mpx D:405-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774567Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
  6. 2774568Protein Alpha-amino acid ester hydrolase [89247] (2 species)
  7. 2774602Species Xanthomonas citri [TaxId:346] [89248] (1 PDB entry)
  8. 2774606Domain d1mpxd1: 1mpx D:405-637 [85047]
    Other proteins in same PDB: d1mpxa2, d1mpxb2, d1mpxc2, d1mpxd2
    complexed with ca, gol

Details for d1mpxd1

PDB Entry: 1mpx (more details), 1.9 Å

PDB Description: alpha-amino acid ester hydrolase labeled with selenomethionine
PDB Compounds: (D:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1mpxd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpxd1 b.18.1.13 (D:405-637) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}
prscdkgcaatskplylqaggklsfqppvagqagfeeyvsdpakpvpfvprpvdfadram
wttwlvhdqrfvdgrpdvltfvteplteplqiagapdvhlqastsgsdsdwvvklidvyp
eemasnpkmggyelpvslaifrgryresfstpkpltsnqplafqfglptanhtfqpghrv
mvqvqsslfplydrnpqtyvpniffakpgdyqkatqrvyvspeqpsyislpvr

SCOPe Domain Coordinates for d1mpxd1:

Click to download the PDB-style file with coordinates for d1mpxd1.
(The format of our PDB-style files is described here.)

Timeline for d1mpxd1: