SCOP 1.73: Domain d1mpxb1: 1mpx B:405-637

Lineage for d1mpxb1 (1mpx B:405-637)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-roll
Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families)
Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)
Protein Alpha-amino acid ester hydrolase [89247] (2 species)
Species Xanthomonas citri [TaxId:346] [89248] (1 PDB entry)
Domain d1mpxb1: 1mpx B:405-637 [85043]
Other proteins in same PDB: d1mpxa2, d1mpxb2, d1mpxc2, d1mpxd2

Details for d1mpxb1

PDB Entry: 1mpx (more details), 1.9 Å

PDB Description: alpha-amino acid ester hydrolase labeled with selenomethionine

PDB Compounds: (B:) alpha-amino acid ester hydrolase

SCOP Domain Sequences for d1mpxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpxb1 b.18.1.13 (B:405-637) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}
prscdkgcaatskplylqaggklsfqppvagqagfeeyvsdpakpvpfvprpvdfadram
wttwlvhdqrfvdgrpdvltfvteplteplqiagapdvhlqastsgsdsdwvvklidvyp
eemasnpkmggyelpvslaifrgryresfstpkpltsnqplafqfglptanhtfqpghrv
mvqvqsslfplydrnpqtyvpniffakpgdyqkatqrvyvspeqpsyislpvr

SCOP Domain Coordinates for d1mpxb1:

Click to download the PDB-style file with coordinates for d1mpxb1.
(The format of our PDB-style files is described here.)

Timeline for d1mpxb1: