SCOPe 2.08: Domain d1mpxb1: 1mpx B:405-637

Lineage for d1mpxb1 (1mpx B:405-637)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.13: PepX C-terminal domain-like [69222] (3 proteins)

6. Protein Alpha-amino acid ester hydrolase [89247] (2 species)

7. Species Xanthomonas citri [TaxId:346] [89248] (1 PDB entry)

8. Domain d1mpxb1: 1mpx B:405-637 [85043]
   Other proteins in same PDB: d1mpxa2, d1mpxb2, d1mpxc2, d1mpxd2
   complexed with ca, gol

Details for d1mpxb1

PDB Entry: 1mpx, 1.9 Å

PDB Description: alpha-amino acid ester hydrolase labeled with selenomethionine

PDB Compounds: (B:) alpha-amino acid ester hydrolase

SCOPe Domain Sequences for d1mpxb1:

Sequence; same for both SEQRES and ATOM records:

>d1mpxb1 b.18.1.13 (B:405-637) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]}
prscdkgcaatskplylqaggklsfqppvagqagfeeyvsdpakpvpfvprpvdfadram
wttwlvhdqrfvdgrpdvltfvteplteplqiagapdvhlqastsgsdsdwvvklidvyp
eemasnpkmggyelpvslaifrgryresfstpkpltsnqplafqfglptanhtfqpghrv
mvqvqsslfplydrnpqtyvpniffakpgdyqkatqrvyvspeqpsyislpvr

Timeline for d1mpxb1:

• d1mpxb1 first appeared in SCOP 1.65
  
• d1mpxb1 appears in SCOPe 2.07