Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein NK cell-activating receptor nkg2d [64453] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [64455] (4 PDB entries) |
Domain d1mpua_: 1mpu A: [85040] complexed with po4 |
PDB Entry: 1mpu (more details), 2.5 Å
SCOPe Domain Sequences for d1mpua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mpua_ d.169.1.1 (A:) NK cell-activating receptor nkg2d {Human (Homo sapiens) [TaxId: 9606]} qipltesycgpcpknwicyknncyqffdesknwyesqascmsqnasllkvyskedqdllk lvksyhwmglvhiptngswqwedgsilspnlltiiemqkgdcalyassfkgyiencstpn tyicmqrt
Timeline for d1mpua_: