Lineage for d1moya_ (1moy A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806367Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 806368Superfamily b.61.1: Avidin/streptavidin [50876] (1 family) (S)
  5. 806369Family b.61.1.1: Avidin/streptavidin [50877] (2 proteins)
  6. 806398Protein Streptavidin [50878] (1 species)
  7. 806399Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)
  8. 806663Domain d1moya_: 1moy A: [85039]
    mutant with osteopontin hexapeptide insertion including rgd

Details for d1moya_

PDB Entry: 1moy (more details), 1.55 Å

PDB Description: Streptavidin Mutant with Osteopontin Hexapeptide Insertion Including RGD
PDB Compounds: (A:) streptavidin

SCOP Domain Sequences for d1moya_:

Sequence, based on SEQRES records: (download)

>d1moya_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapgrgdsvgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkpsaas

Sequence, based on observed residues (ATOM records): (download)

>d1moya_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapgrgdgsgtalg
wtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk
psaas

SCOP Domain Coordinates for d1moya_:

Click to download the PDB-style file with coordinates for d1moya_.
(The format of our PDB-style files is described here.)

Timeline for d1moya_: