Lineage for d1mova_ (1mov A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899123Protein Pocilloporin pigment Rtms5 [89866] (1 species)
  7. 1899124Species Coral (Montipora efflorescens) [TaxId:105610] [89867] (3 PDB entries)
  8. 1899127Domain d1mova_: 1mov A: [85038]
    complexed with iod; mutant

Details for d1mova_

PDB Entry: 1mov (more details), 2.4 Å

PDB Description: crystal structure of coral protein mutant
PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d1mova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mova_ d.22.1.1 (A:) Pocilloporin pigment Rtms5 {Coral (Montipora efflorescens) [TaxId: 105610]}
ggviatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspq
cqygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkf
sglnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykak
kpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d1mova_:

Click to download the PDB-style file with coordinates for d1mova_.
(The format of our PDB-style files is described here.)

Timeline for d1mova_: