Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein Pocilloporin pigment Rtms5 [89866] (1 species) |
Species Coral (Montipora efflorescens) [TaxId:105610] [89867] (3 PDB entries) |
Domain d1mova_: 1mov A: [85038] complexed with iod; mutant |
PDB Entry: 1mov (more details), 2.4 Å
SCOPe Domain Sequences for d1mova_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mova_ d.22.1.1 (A:) Pocilloporin pigment Rtms5 {Coral (Montipora efflorescens) [TaxId: 105610]} ggviatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspq cqygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkf sglnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykak kpvkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva
Timeline for d1mova_: