SCOPe 2.08: Domain d1mova1: 1mov A:7-225

Lineage for d1mova1 (1mov A:7-225)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Pocilloporin pigment Rtms5 [89866] (1 species)

7. Species Coral (Montipora efflorescens) [TaxId:105610] [89867] (3 PDB entries)

8. Domain d1mova1: 1mov A:7-225 [85038]
   Other proteins in same PDB: d1mova2
   complexed with iod; mutant

Details for d1mova1

PDB Entry: 1mov, 2.4 Å

PDB Description: crystal structure of coral protein mutant

PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d1mova1:

Sequence; same for both SEQRES and ATOM records:

>d1mova1 d.22.1.1 (A:7-225) Pocilloporin pigment Rtms5 {Coral (Montipora efflorescens) [TaxId: 105610]}
viatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspqcq
ygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfsg
lnfppngpvmqkktqgwepsserlfarggmlignnfmalkleggghylcefkttykakkp
vkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

Timeline for d1mova1:

• d1mova1 first appeared in SCOP 1.65, called d1mova_
  
• d1mova1 appears in SCOPe 2.07