Lineage for d1moua1 (1mou A:7-225)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940203Protein Pocilloporin pigment Rtms5 [89866] (1 species)
  7. 2940204Species Coral (Montipora efflorescens) [TaxId:105610] [89867] (3 PDB entries)
  8. 2940206Domain d1moua1: 1mou A:7-225 [85037]
    Other proteins in same PDB: d1moua2
    complexed with iod

Details for d1moua1

PDB Entry: 1mou (more details), 2.2 Å

PDB Description: crystal structure of coral pigment
PDB Compounds: (A:) GFP-like non-fluorescent chromoprotein

SCOPe Domain Sequences for d1moua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moua1 d.22.1.1 (A:7-225) Pocilloporin pigment Rtms5 {Coral (Montipora efflorescens) [TaxId: 105610]}
viatqmtykvymsgtvnghyfevegdgkgrpyegeqtvkltvtkggplpfawdilspqcq
ygsipftkypedipdyvkqsfpegftwerimnfedgavctvsndssiqgncftyhvkfsg
lnfppngpvmqkktqgwephserlfarggmlignnfmalkleggghylcefkttykakkp
vkmpgyhyvdrkldvtnhnkdytsveqceisiarkpvva

SCOPe Domain Coordinates for d1moua1:

Click to download the PDB-style file with coordinates for d1moua1.
(The format of our PDB-style files is described here.)

Timeline for d1moua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1moua2