Lineage for d1moea2 (1moe A:120-240)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2022045Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (31 PDB entries)
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
  8. 2022073Domain d1moea2: 1moe A:120-240 [85031]
    Other proteins in same PDB: d1moea1, d1moeb1
    part of anti-CEA scFv T84.66; VL to VH linkage: linker residues 112-119; assembles as a diabody
    complexed with so4

Details for d1moea2

PDB Entry: 1moe (more details), 2.6 Å

PDB Description: the three-dimensional structure of an engineered scfv t84.66 dimer or diabody in vl to vh linkage.
PDB Compounds: (A:) anti-CEA mAb T84.66

SCOPe Domain Sequences for d1moea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1moea2 b.1.1.1 (A:120-240) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
evqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnsky
vpkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvs
s

SCOPe Domain Coordinates for d1moea2:

Click to download the PDB-style file with coordinates for d1moea2.
(The format of our PDB-style files is described here.)

Timeline for d1moea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1moea1