Lineage for d1mn9c_ (1mn9 C:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724082Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 724083Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 724084Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 724130Species Dictyostelium discoideum [TaxId:44689] [54925] (22 PDB entries)
  8. 724182Domain d1mn9c_: 1mn9 C: [85027]
    complexed with mg, rtp; mutant

Details for d1mn9c_

PDB Entry: 1mn9 (more details), 2.9 Å

PDB Description: ndp kinase mutant (h122g) complex with rtp
PDB Compounds: (C:) NDP kinase

SCOP Domain Sequences for d1mn9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mn9c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd
svesanreialwfkpeelltevkpnpnlye

SCOP Domain Coordinates for d1mn9c_:

Click to download the PDB-style file with coordinates for d1mn9c_.
(The format of our PDB-style files is described here.)

Timeline for d1mn9c_: