Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.58: Ferredoxin-like [54861] (51 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein) |
Protein Nucleoside diphosphate kinase, NDK [54921] (13 species) |
Species Dictyostelium discoideum [TaxId:44689] [54925] (21 PDB entries) |
Domain d1mn9c_: 1mn9 C: [85027] complexed with mg, rtp; mutant |
PDB Entry: 1mn9 (more details), 2.9 Å
SCOP Domain Sequences for d1mn9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mn9c_ d.58.6.1 (C:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum} vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniiggsd svesanreialwfkpeelltevkpnpnlye
Timeline for d1mn9c_: