![]() | Class a: All alpha proteins [46456] (226 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (4 families) ![]() |
![]() | Family a.5.2.4: CUE domain [88995] (3 proteins) Pfam 02845 |
![]() | Protein Vacuolar protein sorting-associated protein vps9 [88996] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88997] (2 PDB entries) |
![]() | Domain d1mn3a_: 1mn3 A: [85024] part of the C-terminal helix-swapped homodimer complexed with mse; mutant |
PDB Entry: 1mn3 (more details), 2.3 Å
SCOP Domain Sequences for d1mn3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae)} sslikkieenerkdtlntlqnmfpdmdpsliedvciakksriepcvdallslse
Timeline for d1mn3a_: