Lineage for d1mmfl_ (1mmf L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089476Superfamily c.1.19: Cobalamin (vitamin B12)-dependent enzymes [51703] (4 families) (S)
  5. 2089521Family c.1.19.3: Diol dehydratase, alpha subunit [51710] (2 protein domains)
    automatically mapped to Pfam PF02286
  6. 2089522Protein Diol dehydratase, alpha subunit [51711] (2 species)
  7. 2089538Species Klebsiella pneumoniae [TaxId:573] [82278] (2 PDB entries)
  8. 2089542Domain d1mmfl_: 1mmf L: [85022]
    Other proteins in same PDB: d1mmfb_, d1mmfe_, d1mmfg_, d1mmfm_
    complexed with b12, k

Details for d1mmfl_

PDB Entry: 1mmf (more details), 2.5 Å

PDB Description: Crystal structure of substrate free form of glycerol dehydratase
PDB Compounds: (L:) glycerol dehydrase alpha subunit

SCOPe Domain Sequences for d1mmfl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmfl_ c.1.19.3 (L:) Diol dehydratase, alpha subunit {Klebsiella pneumoniae [TaxId: 573]}
mkrskrfavlaqrpvnqdgligewpeegliamdspfdpvssvkvdngliveldgkrrdqf
dmidrfiadyainverteqamrleaveiarmlvdihvsreeiiaittaitpakavevmaq
mnvvemmmalqkmrarrtpsnqchvtnlkdnpvqiaadaaeagirgfseqettvgiarya
pfnalallvgsqcgrpgvltqcsveeatelelgmrgltsyaetvsvygteavftdgddtp
wskaflasayasrglkmrytsgtgsealmgysesksmlylesrcifitkgagvqglqnga
vscigmtgavpsgiravlaenliasmldlevasandqtfshsdirrtartlmqmlpgtdf
ifsgysavpnydnmfagsnfdaedfddynilqrdlmvdgglrpvteaetiairqkaarai
qavfrelglppiadeeveaatyahgsnempprnvvedlsaveemmkrnitgldivgalsr
sgfediasnilnmlrqrvtgdylqtsaildrqfevvsavndindyqgpgtgyrisaerwa
eiknipgvvqpdtie

SCOPe Domain Coordinates for d1mmfl_:

Click to download the PDB-style file with coordinates for d1mmfl_.
(The format of our PDB-style files is described here.)

Timeline for d1mmfl_: