Class a: All alpha proteins [46456] (290 folds) |
Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies) core: 3 helices; bundle, open |
Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) contains irregular N-terminal subdomain automatically mapped to Pfam PF02287 |
Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (2 proteins) |
Protein Diol dehydratase, gamma subunit [47150] (2 species) |
Species Klebsiella pneumoniae [TaxId:573] [81728] (2 PDB entries) |
Domain d1mmfg_: 1mmf G: [85021] Other proteins in same PDB: d1mmfa_, d1mmfb_, d1mmfe_, d1mmfl_ complexed with b12, k |
PDB Entry: 1mmf (more details), 2.5 Å
SCOPe Domain Sequences for d1mmfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mmfg_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella pneumoniae [TaxId: 573]} dyplatrcpehiltptgkpltditlekvlsgevgpqdvrisrqtleyqaqiaeqmqrhav arnfrraaeliaipderilaiynalrpfrssqaellaiadelehtwhatvnaafvresae vyqqrhklrkgs
Timeline for d1mmfg_: